General Information

  • ID:  hor007115
  • Uniprot ID:  Q06141
  • Protein name:  Regenerating islet-derived protein 3-alpha 16.5 kDa form
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  NA
  • Source:  Human
  • Expression:  Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0030246 carbohydrate binding; GO:0005179 hormone activity; GO:0042834 peptidoglycan binding; GO:0038023 signaling receptor activity; GO:0042802 identical protein binding; GO:0070492 oligosaccharide binding
  • GO CC:  GO:0009611 response to wounding; GO:0009609 response to symbiotic bacterium; GO:0043434 response to peptide hormone; GO:0090303 positive regulation of wound healing; GO:0010838 positive regulation of keratinocyte proliferation; GO:2000972 positive regulation of detection of glucose; GO:0008284 positive regulation of cell population proliferation; GO:0045617 negative regulation of keratinocyte differentiation; GO:0106015 negative regulation of inflammatory response to wounding; GO:0050728 negative regulation of inflammatory response; GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0006953 acute-phase response

Sequence Information

  • Sequence:  EPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
  • Length:  148
  • Propeptide:  MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
  • Signal peptide:  MLPPMALPSVSWMLLSCLMLLSQVQG
  • Modification:  T64 Methionine sulfoxide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA